General Information

  • ID:  hor005979
  • Uniprot ID:  P43443
  • Protein name:  Neuromedin-B
  • Gene name:  nmb
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Brain, intestine, and ovaries and early embryos (stages 2 and 10).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GNQWAIGHFM
  • Length:  10(45-54)
  • Propeptide:  MSAVPLTRMLPLRFLTHLLLLSFIPLYFCMEFSEDARNIEKIRRGNQWAIGHFMGKKSLQDTYNPSEQDMDSEDFRPRIIEMIRGTFRQEPIRALSPRKQDEIQWMLKKIMDDYIKTTQK
  • Signal peptide:  MSAVPLTRMLPLRFLTHLLLLSFIPLYFC
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates smooth muscle contraction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P43443-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005979_AF2.pdbhor005979_ESM.pdb

Physical Information

Mass: 132104 Formula: C53H73N15O13S
Absent amino acids: CDEKLPRSTVY Common amino acids: G
pI: 7.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -9 Boman Index: -57
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 49
Instability Index: -3243 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  1409705
  • Title:  Isolation and sequence of a cDNA encoding the precursor of a bombesinlike peptide from brain and early embryos of Xenopus laevis.